Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Dokumenty

AV49500

Sigma-Aldrich

Anti-PLXDC1 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-DKFZp686F0937, Anti-FLJ36270, Anti-FLJ45632, Anti-Plexin domain containing 1, Anti-TEM3, Anti-TEM7

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

54 kDa

reaktywność gatunkowa

dog, human, rat, mouse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_065138

numer dostępu UniProt

Q8IUK5

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... PLXDC1(57125)

Immunogen

Synthetic peptide directed towards the N terminal region of human PLXDC1

Zastosowanie

Anti-PLXDC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Działania biochem./fizjol.

Plexin domain containing 1 (PLXDC1; tumor endothelial marker 7, TEM7) is a transmembrane and secreted protein containing plexin-like and weak nidogen-like domains. It mediates protein-protein interactions and is associated with angiogenic state of these cells. It is highly expressed in endothelium of tumor cells in a variety of cancer types.

Sekwencja

Synthetic peptide located within the following region: MDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHT

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Judy R van Beijnum et al.
Frontiers in bioscience (Scholar edition), 1, 216-225 (2009-06-02)
Endothelial cells (EC) are attractive targets for therapeutic interference in diseases that are dependent on the formation of novel blood vessels, such as cancer. EC are readily accessible via the blood stream and are considered to be genetically stable, thus
Rebecca G Bagley et al.
Microvascular research, 82(3), 253-262 (2011-10-01)
Antiangiogenesis has been validated as a therapeutic strategy to treat cancer, however, a need remains to identify new targets and therapies for specific diseases and to improve clinical benefit from antiangiogenic agents. Tumor endothelial marker 7 (TEM-7) was investigated as
Akash Nanda et al.
Cancer research, 64(23), 8507-8511 (2004-12-03)
Tumor endothelial marker 7 (TEM7) was recently identified as an mRNA transcript overexpressed in the blood vessels of human solid tumors. Here, we identify several new variants of TEM7, derived by alternative splicing, that are predicted to be intracellular (TEM7-I)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej