AV48999

Anti-NEK7 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-NIMA (never in mitosis gene a)-related kinase 7
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 3

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 34 kDa
• species reactivity: rat, human, mouse, dog, guinea pig, bovine, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_598001
• UniProt accession no.: Q8TDX7
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NEK7(140609)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human NEK7

Application

Anti-NEK7antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

NIMA-related kinase 7 (NEK7), a serine/threonine protein kinase is required for the proper formation of spindle during mitosis. NEK7 recruits centrosomal pericentriolar material (PCM) proteins which are required for centriole duplication and spindle pole formation. Optimum activity of NEK7 is necessary for cell cycle progression during M and G1 phase and during cytokinesis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• Co się dzieje?: WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable