AV48819

Anti-TRMU antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-MGC99627, Anti-MTO2, Anti-MTU1, Anti-TRMT, Anti-TRMT1, Anti-TRNT1, Anti-tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 2

Właściwości

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 48 kDa
• species reactivity: mouse, human, rat, bovine, guinea pig, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_060476
• UniProt accession no.: O75648
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TRMU(55687)

Opis

General description

TRMU codes for tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase that catalyzes the 2-thiolation of uridine. Studies have reported that TRMU mutations affect the deafness-associated mutations in 12S ribosomal RNA.
Rabbit Anti-TRMU antibody recognizes bovine, canine, human, mouse, and rat TRMU.

Immunogen

Synthetic peptide directed towards the C terminal region of human TRMU

Application

Rabbit Anti-TRMU antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable