Przejdź do zawartości
Merck

Przejdź do

AV48228

Anti-TCAP (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-CMD1N, Anti-LGMD2G, Anti-T-cap, Anti-TELE, Anti-Telethonin, Anti-Titin-cap (telethonin)

Zaloguj się, aby wyświetlić ceny organizacyjne i kontraktowe.

Wybierz wielkość

Zmień widok
Rozmiar/SKUDostępnośćCena netto
100 μL
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
1770,00 zł

Informacje o tej pozycji

NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
WB
Citations:
2

1770,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności

Pomoc techniczna
Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.
Pozwól nam pomóc


biological source

rabbit

Quality Segment

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

19 kDa

species reactivity

rabbit, horse, rat, human, dog, goat, guinea pig, bovine, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TCAP(8557)

General description

TCAP codes for a protein that binds to titin and acts as a substrate for titin kinase, thereby playing an important role in sarcomere assembly. Genetic mutations in Tcap have been linked to cardiomyopathies. Depletion of Tcap in zebrafish has been associated with muscular dystrophy.
Rabbit Anti-TCAP antibody recognizes bovine, canine, pig, human, mouse, and rat TCAP.

Immunogen

Synthetic peptide directed towards the middle region of human TCAP

Application

Rabbit Anti-TCAP antibody is suitable for western blot applications at a concentration of 5μg/ml.

Biochem/physiol Actions

Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. This gene encodes a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in this gene are associated with limb-girdle muscular dystrophy type 2G. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.


Still not finding the right product?

Wypróbuj nasze narzędzie Narzędzie selektora produktów, aby zawęzić opcje.


Klasa składowania

10 - Combustible liquids

Co się dzieje?

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable



Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów