AV46773

Anti-SC4MOL antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-DESP4, Anti-ERG25, Anti-MGC104344, Anti-Sterol-C4-methyloxidase-like
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 35 kDa
• reaktywność gatunkowa: pig, rabbit, dog, human, horse, mouse
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_006736
• numer dostępu UniProt: Q15800
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SC4MOL(6307)

Opis

Opis ogólny

Sterol-C4-methyloxidase-like/methylsterol monooxygenase 1 (SC4MOL, DESP4, ERG25, MSMO1) is an endoplasmic reticulum enzyme that catalyzes the demethylation of C4-methlysterols (meiosis-activating sterols, MAS) in the cholesterol synthesis pathway. Defective/mutated SC4MOL contributes to psoriasiform dermatitis, microcephaly, and developmental delay.

Specyficzność

Anti-SC4MOL polyclonal antibody reacts with zebrafish, bovine, pig, human, mouse, rat, and canine sterol-C4-methyloxidase-like proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human SC4MOL

Zastosowanie

Anti-SC4MOL polyclonal antibody is used to tag sterol-C4-methyloxidase-like for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of sterol-C4-methyloxidase-like in the management of C4-methlysterols (meiosis-activating sterols, MAS) levels.

Działania biochem./fizjol.

Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Sekwencja

Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable