AV40640

Anti-SYNCRIP (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Synaptotagmin binding, cytoplasmic RNA interacting protein
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: -

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 69 kDa
• species reactivity: horse, mouse, bovine, rabbit, guinea pig, dog, rat, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_006363
• UniProt accession no.: O60506
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SYNCRIP(10492)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human SYNCRIP

Biochem/physiol Actions

Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable