AV39742

Anti-CPXCR1 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-CPX chromosome region, candidate 1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 1

Właściwości

• Quality Segment: 100
• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 35 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_149037
• UniProt accession no.: Q96RS3
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... CPXCR1(53336)

Opis

General description

CPXCR1 is a candidate gene in the CPX chromosome region and is widely expressed in fetal tissues.
Rabbit Anti-CPXCR1 antibody recognizes human CPXCR1.

Immunogen

Synthetic peptide directed towards the N terminal region of human CPXCR1

Application

Rabbit Anti-CPXCR1 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: SDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• Co się dzieje?: WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable