AV33913

Anti-KIF1C antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Kinesin family member 1C
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 123 kDa
• reaktywność gatunkowa: rabbit, dog, human, bovine, pig
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_006603
• numer dostępu UniProt: O43896
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... KIF1C(10749)

Opis

Immunogen

Synthetic peptide directed towards the C terminal region of human KIF1C

Działania biochem./fizjol.

KIF1C represents a member of the Unc104 subfamily of kinesin-like proteins that are involved in the transport of mitochondria or synaptic vesicles in axons. KIF1C consists of an amino-terminal motor domain followed by a U104 domain and probably binds to target membranes through carboxyl-terminal sequences.

Sekwencja

Synthetic peptide located within the following region: GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable