AV33177

Anti-TBX20 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-T-box 20
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: -

Właściwości

• conjugate: unconjugated
• Quality Segment: 100
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 49 kDa
• species reactivity: horse, human, rabbit, dog, mouse, rat, bovine, pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_001071121
• UniProt accession no.: Q9UMR3
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TBX20(57057)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human TBX20

Biochem/physiol Actions

TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable