AV32841

Anti-CHES1 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Checkpoint suppressor 1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 4

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 52 kDa
• species reactivity: guinea pig, mouse, human, horse, rat, dog, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001078940
• UniProt accession no.: O00409
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CHES1(1112)

Opis

General description

CHES1 (or FOXN3) is a forkhead transcription factor that modulates cell proliferation by supressing PIM2 and protein synthesis. FOXN3 has also been implicated in transcriptional repression, DNA damage responses, hematopoietic cancers, and oral cancers.
Rabbit Anti-CHES1 antibody recognizes chicken, zebrafish, human, mouse, rat, pig, and canine CHES1.

Immunogen

Synthetic peptide directed towards the C terminal region of human CHES1

Application

Rabbit Anti-CHES1 antibody can be used for western blot applications at a concentration of 1.25μg/ml

Biochem/physiol Actions

Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable