AV31652

Anti-ESR2 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Estrogen receptor 2 (ER β)
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 4

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 59 kDa
• species reactivity: mouse, human, pig, bovine, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001428
• UniProt accession no.: Q92731
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ESR2(2100)

Opis

General description

ESR2 is a nuclear transcription factor that belongs to the estrogen receptor family. ESR2 polymorphisms have been linked to anorexia nervosa, blood pressure, breast cancer and endometrial tumors.
Rabbit Anti-ESR2 antibody recognizes canine, human, mouse, rat, pig, and bovine ESR2.

Immunogen

Synthetic peptide directed towards the N terminal region of human ESR2

Application

Rabbit Anti-ESR2 antibody can be used for western blot applications at a dilution of 1μg/ml.

Biochem/physiol Actions

ESR2 is a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: TPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGN

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable