AV09047

Anti-BCL2A1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-BCL2-related protein A1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 3

Właściwości

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 20 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_004040
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BCL2A1(597)

Opis

General description

BCL2 proteins are important regulators of cell death and survival. They are recognized as cellular oncogenes that are often deregulated in cancers.

Immunogen

Synthetic peptide directed towards the C terminal region of human BCL2A1

Application

Anti- BCL2A1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem/physiol Actions

The expression of BCL2A1 protein is regulated by NF-κB transcription factor. It has prosurvival and metastatic effects and facilitates survival of leukocytes subsets and inflammation. It is upregulated in melanomas and chronic inflammatory diseases.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable