APREST94831

PrEST Antigen KCNH6

Prestige Antibodies^® Powered by Atlas Antibodies, buffered aqueous solution

• Synonim(y): HERG2, Kv11.2, erg2
• Kod UNSPSC: 12352203

Właściwości

• rekombinowane: expressed in E. coli
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Próba: >80% (SDS-PAGE)
• Postać: buffered aqueous solution
• masa cząsteczkowa: predicted mol wt 25 kDa
• oczyszczone przez: immobilized metal affinity chromatography (IMAC)
• stężenie: ≥0.5 mg/mL
• uwaga do sekwencji: SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED
• Ensembl | numer dostępu dla gatunku człowiek: ENSG00000173826
• numer dostępu UniProt: Q9H252
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... KCNH6(81033)

Opis

Opis ogólny

N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Zastosowanie

Suitable as a blocking agent and positive assay control using corresponding antibodies.

Powiązanie

Corresponding Antibodies HPA061704

Postać fizyczna

Solution in 1 M urea-PBS, pH 7.4

Przechowywanie i stabilność

Store at -20°C. Avoid repeated freeze/thaw cycles.

Inne uwagi

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 12 - Non Combustible Liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable