AMAB91792

Anti-TMPRSS2 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL12511, purified by using Protein A, buffered aqueous glycerol solution

• Synonim(y): PRSS10
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• rodzaj przeciwciała: primary antibodies
• klon: CL12511, monoclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• oczyszczone przez: using Protein A
• reaktywność gatunkowa: human
• rozszerzona walidacja: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• metody: immunohistochemistry: 1:1000-1:2500
• izotyp: IgG1
• Ensembl | numer dostępu dla gatunku człowiek: ENSG00000184012
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... TMPRSS2(7113)

Opis

Immunogen

Transmembrane serine protease 2

Zastosowanie

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Cechy i korzyści

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Sekwencja

GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT

Powiązanie

Corresponding Antigen APREST76121

Postać fizyczna

The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Przechowywanie i stabilność

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1