171596

β-Amyloid Peptide

≥80% (HPLC), lyophilized, 1-42, rat

• Synonim(y): DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
• Wzór empiryczny (zapis Hilla): C₁₉₉H₃₀₇N₅₃O₅₉S
• Numer CAS: 107761-42-2
• Masa cząsteczkowa: 4417.95
• UNSPSC Code: 12352202
• NACRES: NA.26
• MDL number: MFCD00163049

Właściwości

• Nazwa produktu: Peptyd β-amyloidowy (1-42), szczur,
• description: Predominant peptide found in the brain of patients with Alzheimer′s Disease and Down′s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
• Quality Segment: 100
• assay: ≥80% (HPLC)
• form: lyophilized
• manufacturer/tradename: Calbiochem^®
• storage condition: OK to freeze, desiccated (hygroscopic)
• solubility: 5% acetic acid: 1 mg/mL
• shipped in: ambient
• storage temp.: −20°C
• SMILES string: S(CC[C@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(
• InChI: 1S/C203H311N55O60S/c1-28-106(20)164(195(310)220-91-149(267)228-130(71-98(4)5)181(296)238-129(66-70-319-27)179(294)251-158(100(8)9)193(308)218-87-146(264)215-88-151(269)250-160(102(12)13)198(313)255-163(105(18)19)199(314)258-165(107(21)29-2)200(315)227-112
• InChI key: DZHSAHHDTRWUTF-SIQRNXPUSA-N

Opis

General description

β-Amyloid Peptide (Aβ) is the main constituent in both senile plaques and diffuse deposits in Alzheimer′s diseased brains. Under appropriate conditions, the soluble amyloid peptides aggregate into the fibrils associated with the disease state. It has proposed that Aβ peptide may increase the sensitivity of neurons to oxidative damage by downregulating expression of bcl-2, a key anti-apoptotic protein and upregulating of bax expression, a protein known to induce cell death.

Predominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.

Other Notes

H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Paradis, E., et al. 1996. J. Neurosci.16, 7533.
Roher, A.E., et al. 1996. J. Biol. Chem.271, 20631.
Soto, C., and Castano, E.M. 1996. Biochem. J.314, 701.
Murrell, J., et al. 1991. Science254, 97.
Goldgaber, D., et al. 1987. Science235, 877.
Kang, J., et al. 1987. Nature 325, 733.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Toxicity: Standard Handling (A)

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 11 - Combustible Solids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable