Skip to Content
Merck
All Photos(6)

Key Documents

HPA024018

Sigma-Aldrich

Anti-GOPC antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CFTR-associated ligand, Anti-Fused in glioblastoma, Anti-Golgi-associated PDZ and coiled-coil motif-containing protein, Anti-PDZ protein interacting specifically with TC10, Anti-PIST

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
PLN 2,440.00

PLN 2,440.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
PLN 2,440.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

PLN 2,440.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

IEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLY

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GOPC(57120)

General description

The gene GOPC (Golgi-associated PDZ and coiled-coil motif-containing protein) is mapped to human chromosome 6q22.1. The protein has a single PDZ (PSD-95, Discs-large and ZO-1)-domain, two coiled-coil motifs and two evolutionarily conserved regions, needed for Golgi localization. The protein is also referred to as CAL (CFTR-associated ligand), PIST (PDZ protein interacting specifically with TC10) and FIG (fused in glioblastoma).[1]

Immunogen

Golgi-associated PDZ and coiled-coil motif-containing protein recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

GOPC (Golgi-associated PDZ and coiled-coil motif-containing protein) mainly regulates the intracellular trafficking of receptors. It interacts with β1-adrenergic receptor and mGluR1a (metabotropic glutamate receptor 1A). GOPC retains the receptors in the cell, thereby reducing their expression on the cell surface. It also controls the recycling and degradation of somatostatin receptor and mGluR5a. GOPC also interacts with CRFR1 (corticotropin-releasing hormone receptor 1) and suppresses the anterograde transport of the protein from the endoplasmic reticulum-Golgi to the cell membrane surface.[1] In mouse model, GOPC-ROS (proto-oncogene tyrosine-protein kinase) fusion gene enhances ICC (intrahepatic cholangiocarcinoma) development.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74788

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Data on affected cancer-related genes in pediatric t(12;21)-positive acute lymphoblastic leukemia patients harboring unbalanced der(6)t(X;6) translocations.
Kjeldsen E
Data in Brief, 8, 894-903 (2016)
Mouse model of intrahepatic cholangiocarcinoma validates FIG-ROS as a potent fusion oncogene and therapeutic target.
Saborowski A, et al.
Proceedings of the National Academy of Sciences of the USA, 110, 19513-19518 (2013)
The golgi-associated PDZ domain protein PIST/GOPC stabilizes the ?1-adrenergic receptor in intracellular compartments after internalization.
Koliwer J, et al.
The Journal of Biological Chemistry, 290, 6120-6129 (2015)
Malte Klüssendorf et al.
Molecular neurobiology, 58(11), 5618-5634 (2021-08-13)
In neuronal cells, many membrane receptors interact via their intracellular, C-terminal tails with PSD-95/discs large/ZO-1 (PDZ) domain proteins. Some PDZ proteins act as scaffold proteins. In addition, there are a few PDZ proteins such as Gopc which bind to receptors
Maha M Hammad et al.
Cellular signalling, 27(10), 2120-2130 (2015-06-28)
Corticotropin releasing factor (CRF) receptor1 (CRFR1) is associated with psychiatric illness and is a proposed target for the treatment of anxiety and depression. Like many G protein-coupled receptors (GPCRs), CRFR1 harbors a PDZ (PSD95/Disc Large/Zona Occludens 1)-binding motif at the

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service