HPA015475
Anti-NOX4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-KOX-1, Anti-Kidney superoxide-producing NADPH oxidase, Anti-NADPH oxidase 4, Anti-Renal NAD(P)H-oxidase
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
UNSPSC Code:
12352203
Human Protein Atlas Number:
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
ISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYI
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NOX4(50507)
General description
NOX4 (NADPH oxidase 4) belongs to the NOX family of proteins, and is the major member of this family to be expressed in human brain pericytes. It is also highly expressed in kidney, endothelial and vascular smooth muscle cells. It resides in mitochondrial membrane and endoplasmic reticulum (ER). It is a transmembrane protein, which contains two heme groups, and its C-terminal contains flavin adenine dinucleotide and NADPH-binding domains.
Immunogen
NADPH oxidase 4 recombinant protein epitope signature tag (PrEST)
Application
Anti-NOX4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
NOX4 (NADPH oxidase 4) is involved in the growth and proliferation of human brain pericytes. It is activated by hypoxia and angiotensin II, and is responsible for the production of reactive oxygen species (ROS) in brain pericyte membranes, in an NAD(P)H-dependent manner. It might be one of the factors involved in the pathogenesis of cardiovascular disorders. It is involved in pathogen elimination, where NOX-4-produced ROS, by phagocytes, facilitates autophagy. This also determines the survival of vascular and tumor cells. In hypoxic conditions, this protein facilitates erythropoietin secretion in kidney. It has cardioprotective role during energy crisis, and this is achieved by the activation of Nox4/PERK/eIF-2α/ATF4 signaling cascade. NOX4-produced ROS also regulates the activation of redox-sensitive pathways, which in turn determines the replication of Influenza virus in the epithelial cells of lungs.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST73209
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Nicole M Fletcher et al.
Reproductive sciences (Thousand Oaks, Calif.), 21(9), 1145-1152 (2014-02-13)
Uterine fibroids are the most common benign tumor in women. The goal of this study was to investigate whether nicotinamide adenine dinucleotide phosphate oxidase (NOX), a major source of superoxide and subsequent oxidative stress, was differentially regulated in myometrium versus
Sebastiano Sciarretta et al.
Circulation research, 113(11), 1253-1264 (2013-10-02)
Autophagy is an essential survival mechanism during energy stress in the heart. Oxidative stress is activated by energy stress, but its role in mediating autophagy is poorly understood. NADPH oxidase (Nox) 4 is an enzyme that generates reactive oxygen species
Donatella Amatore et al.
Cellular microbiology, 17(1), 131-145 (2014-08-27)
An overproduction of reactive oxygen species (ROS) mediated by NADPH oxidase 2 (NOX2) has been related to airway inflammation typical of influenza infection. Virus-induced oxidative stress may also control viral replication, but the mechanisms underlying ROS production, as well as
N M Fletcher et al.
Reproductive sciences (Thousand Oaks, Calif.), 21(8), 1050-1059 (2014-02-12)
We have previously reported that superoxide (O2•-) contributes to the development of postoperative adhesions. In this study, we determined whether O2•- generating nicotinamide adenine dinucleotide phosphate oxidase (NOX) is differentially expressed in normal peritoneal and adhesion fibroblasts and tissues. The
Sebastiano Sciarretta et al.
Clinical science (London, England : 1979), 128(7), 387-403 (2014-12-18)
In the past several years, it has been demonstrated that the reactive oxygen species (ROS) may act as intracellular signalling molecules to activate or inhibit specific signalling pathways and regulate physiological cellular functions. It is now well-established that ROS regulate
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service