Skip to Content
Merck
All Photos(1)

Key Documents

AV35908

Sigma-Aldrich

Anti-TRIP4 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Thyroid hormone receptor interactor 4

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
PLN 1,700.00

PLN 1,700.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
PLN 1,700.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

PLN 1,700.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

66 kDa

species reactivity

guinea pig, dog, bovine, mouse, rat, rabbit, human, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TRIP4(9325)

Immunogen

Synthetic peptide directed towards the middle region of human TRIP4

Biochem/physiol Actions

TRIP4, also referred to as human activating signal cointegrator 1 (hASC-1), is a transcriptional coactivator of nuclear receptors. The ASC-1 complex is a transactivator for NF-κB, AP-1 and SRF signaling.[1] The expression of TRIP4 acts as a marker of disease progression for Alzheimer′s disease.[2]

Sequence

Synthetic peptide located within the following region: VCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A Ruiz et al.
Translational psychiatry, 4, e358-e358 (2014-02-06)
To follow-up loci discovered by the International Genomics of Alzheimer's Disease Project, we attempted independent replication of 19 single nucleotide polymorphisms (SNPs) in a large Spanish sample (Fundació ACE data set; 1808 patients and 2564 controls). Our results corroborate association
Dong-Ju Jung et al.
Molecular and cellular biology, 22(14), 5203-5211 (2002-06-22)
Human activating signal cointegrator 1 (hASC-1) was originally isolated as a transcriptional coactivator of nuclear receptors. Here we report that ASC-1 exists as a steady-state complex associated with three polypeptides, P200, P100, and P50, in HeLa nuclei; stimulates transactivation by

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service