Skip to Content
Merck
All Photos(6)

Key Documents

HPA014518

Sigma-Aldrich

Anti-P2RY12 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-HORK3, Anti-P2Y12, Anti-SP1999

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:1000-1:2500

immunogen sequence

KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... P2RY12(64805)

General description

Purinergic receptor P2Y G protein-coupled 12 (P2RY12) is encoded by the gene mapped to human chromosome 3q25.1. The encoded protein belongs to the family of P2 purinergic receptors. P2RY12 is characterized with seven transmembrane G protein coupled receptors (GPCRs) that contributes to ATP-and ADP-mediated cell migration in vitro. The protein is expressed in activated platelets and microglial cells.

Immunogen

purinergic receptor P2Y, G-protein coupled, 12

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Anti-P2RY12 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

Purinergic receptor P2Y G protein-coupled 12 (P2RY12) interacts with its ligand ADP and gets activated. This activated receptor plays a vital role in increasing the platelet responses that underlie arterial thrombosis and associated inflammation. P2RY12 is also involved in maintaining thrombus stability in-vivo.Mutation in the gene is associated with the development of ADP receptor deficiency and blood pressure-related disorders. Inhibition of P2RY12 is considered to be a potent therapeutic method for treating pathologic bone loss.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72771

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jannis Wißfeld et al.
Scientific reports, 11(1), 13462-13462 (2021-07-01)
CD33/Sialic acid-binding Ig-like lectin 3 (SIGLEC3) is an innate immune receptor expressed on myeloid cells and mediates inhibitory signaling via tyrosine phosphatases. Variants of CD33 are associated with Alzheimer's disease (AD) suggesting that modulation of CD33 signaling might be beneficial
Ticagrelor yields consistent dose-dependent inhibition of ADP-induced platelet aggregation in patients with atherosclerotic disease regardless of genotypic variations in P2RY12, P2RY1, and ITGB3.
Storey R F, et al.
Platelets, 20(5), 341-348 (2009)
iPSC-derived human microglia-like cells to study neurological diseases.
Abud E M, et al.
Neuron, 94(2), 278-293 (2017)
Expression site of P2RY12 in residential microglial cells in astrocytomas correlates with M1 and M2 marker expression and tumor grade.
Zhu C, et al.
Acta Neuropathologica Communications, 5(1), 4-4 (2017)
Genome-wide linkage and positional candidate gene study of blood pressure response to dietary potassium intervention: the genetic epidemiology network of salt sensitivity study.
Kelly T N, et al.
Circulation: Genomic and Precision Medicine, 3(6), 539-547 (2010)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service