Skip to Content
Merck
All Photos(4)

Key Documents

HPA005525

Sigma-Aldrich

Anti-PRMT5 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-72 kDa ICln-binding protein antibody produced in rabbit, Anti-Jak-binding protein 1 antibody produced in rabbit, Anti-Protein arginine N-methyltransferase 5 antibody produced in rabbit, Anti-SKB1Hs antibody produced in rabbit, Anti-Shk1 kinase-binding protein 1 homolog antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, mouse, rat

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHF

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PRMT5(10419)

General description

PRMT5 (protein arginine methyltransferase 5) belongs to the family of protein methyltransferases. It is a human homologue of Schizosaccaromyces pombe Skb1 (Shk1 kinase-binding protein 1), and Saccharomyces cerevisiae HSL7 (histone synthetic lethal 7) proteins. This gene is localized to the chromosome 14q11.2-21. It contains the motif characteristic of protein arginine methyltransferase (PRMT) family, which are S-adenosyl-L-methionine-dependent. This protein is a type II arginine methyltransferase. It is predominantly expressed in the cytoplasm.

Immunogen

Protein arginine N-methyltransferase 5 recombinant protein epitope signature tag (PrEST)

Application

Anti-PRMT5 antibody is suitable for immunoprecipitation and ChIP (chromatin immunoprecipitation).
Anti-PRMT5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PRMT5 (protein arginine methyltransferase 5) forms monomethylarginine or symmetrical dimethylarginine (MMA/sDMA) by methylating isolated arginine residues or arginine residues found in glycine- and arginine-rich (GAR) motifs. As it forms a part of various protein complexes, it plays essential roles in multiple cellular process. It regulates chromatin remodeling, leading to either gene activation or repression. Cell proliferation and survival is regulated by PRMT5, through extracellular signal-regulated kinase (ERK) pathway. It methylates CRAF (c-Rapidly Accelerated Fibrosarcoma) and BRAF (b-Rapidly Accelerated Fibrosarcoma), which in turn phosphorylate ERK protein. It methylates ribosomal protein S10 (RPS10) at the Arg (158) and Arg (160) residues. RPS10, in turn regulates the assembly of ribosomes, cell proliferation and protein synthesis. Therefore, PRMT5 is involved in tumorigenesis by regulating cell proliferation. PRMT5 is also associated with inflammation and related diseases, such as atherosclerosis, by regulating HOXA9, which has a pro-inflammatory function.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70548

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yusuke Amano et al.
Pathology international, 68(6), 359-366 (2018-04-01)
Protein arginine methyltransferases (PRMT) 5, a member of type II arginine methyltransferases, catalyzes the symmetrical dimethylation of arginine residues on histone and non-histone substrates. Although the overexpression of PRMT5 has been reported in various cancers, its role in oral squamous
Jinqi Ren et al.
The Journal of biological chemistry, 285(17), 12695-12705 (2010-02-18)
Modulation of ribosomal assembly is a fine tuning mechanism for cell number and organ size control. Many ribosomal proteins undergo post-translational modification, but their exact roles remain elusive. Here, we report that ribosomal protein s10 (RPS10) is a novel substrate
Pedro Andreu-Pérez et al.
Science signaling, 4(190), ra58-ra58 (2011-09-16)
The RAS to extracellular signal-regulated kinase (ERK) signal transduction cascade is crucial to cell proliferation, differentiation, and survival. Although numerous growth factors activate the RAS-ERK pathway, they can have different effects on the amplitude and duration of the ERK signal
Yun Teng et al.
Cancer research, 67(21), 10491-10500 (2007-11-03)
AS1411 is a quadruplex-forming oligonucleotide aptamer that targets nucleolin. It is currently in clinical trials as a treatment for various cancers. We have proposed that AS1411 inhibits cancer cell proliferation by affecting the activities of certain nucleolin-containing complexes. Here, we
Smarajit Bandyopadhyay et al.
Molecular and cellular biology, 32(7), 1202-1213 (2012-01-25)
The induction of proinflammatory proteins in stimulated endothelial cells (EC) requires activation of multiple transcription programs. The homeobox transcription factor HOXA9 has an important regulatory role in cytokine induction of the EC-leukocyte adhesion molecules (ELAM) E-selectin and vascular cell adhesion

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service