Skip to Content
Merck
All Photos(5)

Documents

HPA042451

Sigma-Aldrich

Anti-SETD2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Setd2 Antibody, Setd2 Antibody - Anti-SETD2 antibody produced in rabbit, Anti-Flj23184, Anti-Hif-1, Anti-Hypb, Anti-Kiaa1732, Anti-Kmt3a, Anti-Set domain containing 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SETD2(29072)

General description

SET domain containing 2 (SETD2) is a histone methyltransferase gene and is mapped on human chromosome 3p21.31, a region associated with growth arrest of cancer cells.

Immunogen

SET domain containing 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SETD2 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

SET domain containing 2 (SETD2) plays a vital role in trimethylation of the histone mark H3K36 (histone 3 lysine 36). Mutation of this tumor suppressor gene (TSG) is associated with the pathogenesis of various cancers including, clear cell renal cell carcinoma (cRCC), breast cancer, lung cancer, acute lymphoblastic leukemia(ALL), and glioma. In addition, SETD2 gene is also involved in the development of Huntington′s disease (HD). SETD2 plays an important role in the transcriptional elongation by maintaining chromatin structure through association with hyperphosphorylated RNA polymerase II (POLR2A). SETD2 interacts with p53 and acts as a tumor suppressor in breast cancer cells. SETD2 is implicated in DNA double-strand break (DSB) exclusion and homologous recombination (HR) repair in human cells. SETD2 in HeLa cells alters nucleosome organization via decreasing the recruitment of the FACT (facilitates chromatin transcription) complex to active genes.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79513

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

In Young Park et al.
mAbs, 8(8), 1590-1597 (2016-10-30)
Posttranslational modifications (PTMs) on microtubules differentiate these cytoskeletal elements for a variety of cellular functions. We recently identified SETD2 as a dual-function histone and microtubule methyltransferase, and methylation as a new microtubule PTM that occurs on lysine 40 of α-tubulin
Histone methyltransferase SETD2 coordinates FACT recruitment with nucleosome dynamics during transcription.
Carvalho S
Nucleic Acids Research null
Robert Hapke et al.
Kidney cancer journal : official journal of the Kidney Cancer Association, 6(3), 179-193 (2023-01-24)
SET domain-containing protein 2 (SETD2) is commonly mutated in renal cell carcinoma. SETD2 methylates histone H3 as well as a growing list of non-histone proteins. Initially, we sought to explore SETD2-dependent changes in lysine methylation of proteins in proximal renal
Histone methyltransferase gene SETD2 is a novel tumor suppressor gene in clear cell renal cell carcinoma.
Duns G
Cancer Research null
Xian-De Liu et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 29(19), 4002-4015 (2023-08-01)
Immune checkpoint blockade (ICB) demonstrates durable clinical benefits in a minority of patients with renal cell carcinoma (RCC). We aimed to identify the molecular features that determine the response and develop approaches to enhance it. We investigated the effects of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service