Skip to Content
Merck
All Photos(7)

Documents

HPA017437

Sigma-Aldrich

Anti-CTPS2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CTP synthase 2, Anti-CTP synthetase 2, Anti-UTP--ammonia ligase 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CTPS2(56474)

General description

Cytidine triphosphate synthetase 2 (CTPS2), mapped to human chromosome Xp22, codes for CTPS 2 enzyme, which is expressed ubiquitously. Cytidine triphosphate synthetase 2 is an isoenzyme of hCTPS. It shares 50% identity with yeast isoforms of CTPS. CTPS comprises 525–630 amino acid residues along with synthetase domain and glutaminase domain.

Immunogen

CTP synthase 2 recombinant protein epitope signature tag (PrEST)

Application

Anti-CTPS2 antibody produced in rabbit has been used in western blotting. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Cytidine triphosphate synthetase (CTPS) acts as a rate limiting enzyme in the synthesis of cytidine triphosphate from both de novo and uridine salvage pathways. Cytidine nucleotides play a vital role in various metabolic processes and provide the precursor for synthesis of nucleic acids and phospholipids. Decrease in cytosine triphosphate synthase 2 expression elevates colorectal cancer cell resistance to 5-fluorouracil.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74008

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Low cytosine triphosphate synthase 2 expression renders resistance to 5-fluorouracil in colorectal cancer.
Tan WL
Cancer Biology & Therapy, 11(6), 599-608 (2011)
CTP synthase 1 deficiency in humans reveals its central role in lymphocyte proliferation.
Martin E
Nature, 510(7504), 288-292 (2014)
Identification of a cDNA encoding an isoform of human CTP synthetase.
Van kuilenburg AB
Biochimica et Biophysica Acta, 1492(2-3), 548-552 (2000)
Crystal structure of Escherichia coli cytidine triphosphate synthetase, a nucleotide-regulated glutamine amidotransferase/ATP-dependent amidoligase fusion protein and homologue of anticancer and antiparasitic drug targets.
Endrizzi JA
Biochemistry, 43(21), 6447-6463 (2004)
Regulation of human cytidine triphosphate synthetase 2 by phosphorylation.
Kassel KM
The Journal of Biological Chemistry, 285(44), 33727-33736 (2010)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service