AV48981

Anti-PWWP2A antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-KIAA1935, Anti-MGC132770, Anti-MST101, Anti-PWWP domain containing 2A
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 61 kDa
• species reactivity: dog, human, rabbit, guinea pig, rat, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_443159
• UniProt accession no.: Q96N64
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PWWP2A(114825)

Description

Immunogen

Synthetic peptide directed towards the C terminal region of human PWWP2A

Application

Anti-PWWP2A antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

PWWP2A is a zinc finger protein that regulates histone methylation and recruits demethylation complex to histone-bound DNA.[1]

Sequence

Synthetic peptide located within the following region: PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable