Skip to Content
Merck
All Photos(2)

Documents

AV33623

Sigma-Aldrich

Anti-CLDN1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Claudin 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

23 kDa

species reactivity

human, dog, sheep, horse, bovine, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CLDN1(9076)

General description

Claudin-1 (CLDN1) membrane protein belongs to the claudin family. It comprises four membrane-spanning regions, N- and C-terminal cytoplasmic domains, and two extracellular loops. The CLDN1 gene is mapped to human chromosome 3q28. It is expressed in the kidney, testis, intestine, brain, and liver.

Immunogen

Synthetic peptide directed towards the C terminal region of human CLDN1

Biochem/physiol Actions

Claudin-1 (CLDN1) is a key component of the tight junctions that mediate epithelial barrier functions. CLDN1 is dichotomous as it is downregulated in breast, esophageal and prostate cancer. The gene is overexpressed in oral squamous cell cancer, colon, nasopharyngeal and ovarian tumors. It is implicated in neonatal sclerosing cholangitis (NISCH) syndrome. CLDN1 is involved in dengue (DENV) entry and acts as a co-receptor for hepatitis C virus (HCV) entry.

Sequence

Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ajaz A Bhat et al.
International journal of molecular sciences, 21(2) (2020-01-19)
Claudins, a group of membrane proteins involved in the formation of tight junctions, are mainly found in endothelial or epithelial cells. These proteins have attracted much attention in recent years and have been implicated and studied in a multitude of
Pulin Che et al.
Virology, 446(1-2), 303-313 (2013-10-01)
Dengue disease is becoming a huge public health concern around the world as more than one-third of the world's population living in areas at risk of infection. In an effort to assess host factors interacting with dengue virus, we identified
Anne A Blanchard et al.
PloS one, 11(9), e0163387-e0163387 (2016-09-21)
The claudin 1 tight junction protein, solely responsible for the barrier function of epithelial cells, is frequently down regulated in invasive human breast cancer. The underlying mechanism is largely unknown, and no obvious mutations in the claudin 1 gene (CLDN1)
Smail Hadj-Rabia et al.
Gastroenterology, 127(5), 1386-1390 (2004-11-03)
Most human and animal cholestatic disorders are associated with changes in hepatocyte cytoskeleton and tight junctions (TJs). These changes are usually secondary and nonspecific phenomena, both in intra- and extrahepatic cholestasis. Recently, missense mutations in TJ protein 2 (ZO-2) have

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service