TCFL5 is a basic helix-loop-helix (bHLH) protein that is expressed in primary spermatocytes. Studies in mice have revealed that Tcfl5 associated with the Calmegin gene promoter during spermatogenesis. Rabbit Anti-TCFL5 antibody recognizes mouse and human TCFL5.
Immunogen
Synthetic peptide directed towards the middle region of human TCFL5
Application
Rabbit Anti-TCFL5 antibody can be used for western blot assays at a concentration of 2.0μg/ml. The antibody product can also be used for IHC applications (4-8μg/ml, using paraffin-embedded tissues).
Biochem/physiol Actions
TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.
Sequence
Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Cytogenetics and cell genetics, 82(1-2), 41-45 (1998-10-09)
We have isolated a novel human gene that is expressed specifically in primary spermatocytes in the testis. The cDNA contains an open reading frame of 1356 bp, encoding a 452-amino-acid protein that includes a basic Helix-Loop-Helix (bHLH) motif. The gene
In mouse spermatogenesis, differentiating germ line cells initiate expression of specific genes at subsequent developmental steps. The Calmegin (Clgn) gene is first expressed in meiotic prophase, in primary spermatocytes, and encodes a protein that acts as a chaperone. To identify
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.