Skip to Content
Merck
All Photos(1)

Key Documents

HPA010957

Sigma-Aldrich

Anti-NRG4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Pro-NRG4 antibody produced in rabbit, Anti-Pro-neuregulin-4, membrane-bound isoform antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NRG4(145957)

General description

NRG4 (neuregulin 4) belongs to a family of epidermal growth factors (EGFs), which in human has four members, from NRG1- NRG4. It is a transmembrane protein containing 115 amino acids, and has an EGF domain. The EGF domain is located at the N-terminal, which also contains one N-linked glycosylation site. This protein contains another isoform called NRG4A2, which contains a putative type I PDZ-binding peptide, in the C-terminal. NRG4 has limited expression in adult tissues and is not expressed in brain. Both the isoforms of NRG4, NRG4A1 and NRG4A2, are expressed on the surface of the cell, where NRG4A2 is found in punctate membrane regions and NRG4A1 resides at membrane ruffles.

Immunogen

Pro-neuregulin-4, membrane-bound isoform recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

NRG4 (neuregulin 4) binds exclusively to and activates ERBB4 (erb-b2 receptor tyrosine kinase 4), and therefore, might play a role in mediating the ERBB4 related cellular responses. For instance, the interaction of NRG4 with ERBB4 induces survival pathway in colon epithelial cells. Expression of NRG4 and its receptor ERBB4 is related to better prognosis and survival rates in patients with bladder cancer. This gene is up-regulated in prostate cancer, and its overexpression is correlated to the advanced-stage of prostate cancer. It is a brown adipose tissue (BAT)-enriched secreted factor that suppresses lipogenic signaling in liver, and maintains lipid and glucose homeostasis in obese individuals. Aberrant NRG4 signaling might be implicated in the pathogenesis of non-alcoholic fatty liver disease (NAFLD) and type 2 diabetes.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72227

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nandini V L Hayes et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 13(11), 3147-3155 (2007-06-05)
The neuregulin (NRG) 1, 2, and 3 genes undergo extensive alternative mRNA splicing, which results in variants that show structural and functional diversity. The aims of this study were to establish whether the fourth member of this family, NRG4, is
N V L Hayes et al.
Oncogene, 27(5), 715-720 (2007-08-09)
The NRG4 gene is a member of a family of four genes that encode a class of epidermal growth factors. This gene has been reported to express a protein designated here as NRG4A1. We describe here a novel splice variant
A A Memon et al.
British journal of cancer, 91(12), 2034-2041 (2004-12-08)
The epidermal growth factor system has been associated to prognosis in patients with bladder cancer based mainly on the expression of the epidermal growth factor (EGF) receptor 1 (EGFR) and HER2 and their activating ligands. Since limited information exists concerning
Jessica K Bernard et al.
The Journal of biological chemistry, 287(47), 39850-39858 (2012-10-04)
Expression of the ErbB4 tyrosine kinase is elevated in colonic epithelial cells during inflammatory bowel disease, whereas ErbB4 overexpression in cultured colonocytes blocks TNF-induced apoptosis in a ligand-dependent manner. Together, these observations suggest that ErbB4 induction may be a protective
Guo-Xiao Wang et al.
Nature medicine, 20(12), 1436-1443 (2014-11-18)
Brown fat activates uncoupled respiration in response to cold temperature and contributes to systemic metabolic homeostasis. To date, the metabolic action of brown fat has been primarily attributed to its role in fuel oxidation and uncoupling protein 1 (UCP1)-mediated thermogenesis.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service