Skip to Content
Merck
All Photos(7)

Key Documents

HPA004899

Sigma-Aldrich

Anti-BCL6 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-B-cell lymphoma 6 protein antibody produced in rabbit, Anti-BCL-5 antibody produced in rabbit, Anti-BCL-6 antibody produced in rabbit, Anti-LAZ-3 protein antibody produced in rabbit, Anti-Zinc finger and BTB domain-containing protein 27 antibody produced in rabbit, Anti-Zinc finger protein 51 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

availability

not available in USA

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BCL6(604)

General description

BCL6 (B-cell CLL/lymphoma 6) is a nuclear protein, belonging to the BTB/POZ (BR-C, ttk and bab/Pox virus and Zinc finger) domain family of transcription factors. This zinc finger transcription factor has a molecular mass of 95kDa.

Immunogen

B-cell lymphoma 6 protein recombinant protein epitope signature tag (PrEST)

Application

Anti-BCL6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

BCL6 (B-cell CLL/lymphoma 6) is mainly involved in the regulation of B lymphocyte development and growth. Bcl6 acts as a diagnostic marker to identify the level of severity of various diseases. It is predominantly expressed in human cancers such as lymphoid malignancy, breast cancer. In breast cancer, it is associated with the proliferation, anchorage-independent growth, migration, and invasion. It is involved in the BCL6 translocation of primary central nervous system lymphoma, which is further linked with apoptosis process. It is a prime gene in B-cell lymphomagenesis. It has been reported that BCL6 may have corealtion with the preeclampsia.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86935

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nina Kerres et al.
Cell reports, 20(12), 2860-2875 (2017-09-21)
The transcription factor BCL6 is a known driver of oncogenesis in lymphoid malignancies, including diffuse large B cell lymphoma (DLBCL). Disruption of its interaction with transcriptional repressors interferes with the oncogenic effects of BCL6. We used a structure-based drug design to
B-cell lymphoma 6 protein stimulates oncogenicity of human breast cancer cells.
Wu Q, Liu X, Yan H, et al.
BMC Cancer, 14, 418-418 (2014)
Stefanie Schlager et al.
Oncotarget, 11(9), 875-890 (2020-03-18)
Diffuse large B-cell lymphoma (DLBCL) is the most common type of non-Hodgkin lymphomas worldwide and is characterized by a high diversity of genetic and molecular alterations. Chromosomal translocations and mutations leading to deregulated expression of the transcriptional repressor BCL6 occur
Targeted gene analysis: increased B-cell lymphoma 6 in preeclamptic placentas.
Louwen F, Muschol-Steinmetz C, Friemel A, et al.
Human Pathology, 45(6), 1234-1242 (2014)
Tatjana Crnogorac-Jurcevic et al.
PloS one, 8(1), e54830-e54830 (2013-02-02)
With less than a 5% survival rate pancreatic adenocarcinoma (PDAC) is almost uniformly lethal. In order to make a significant impact on survival of patients with this malignancy, it is necessary to diagnose the disease early, when curative surgery is

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service