The human EFG is synthesized as a long preproprotein of 1207 amino acids. The bioactive fragment (from amino acids 970 to 1023) is released by proteolytic cleavage. Please see the sequence below as well as the link to the Uniprot profile:
https://www.uniprot.org/uniprotkb/P01133/entry
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
E9644
Epidermal Growth Factor, human
≥97% (SDS-PAGE), recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
Synonym(s):
Epidermal Growth Factor human, EGF
About This Item
Recommended Products
Product Name
hEGF, EGF, recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
biological source
human
Quality Level
recombinant
expressed in E. coli
Assay
≥97% (SDS-PAGE)
form
lyophilized powder
potency
0.08-0.8 ng/mL ED50/EC50
mol wt
~6 kDa
packaging
pkg of 5X0.2 mg
pkg of 0.2 mg
pkg of 0.5 mg
storage condition
avoid repeated freeze/thaw cycles
technique(s)
cell culture | mammalian: suitable
impurities
≤1 EU/μg endotoxin (EGF)
color
white
solubility
water: soluble, clear, colorless
UniProt accession no.
storage temp.
−20°C
SMILES string
S(CC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H]%12N(CCC%12)C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N
InChI
1S/C270H401N73O83S7/c1-24-134(19)217(262(420)293-112-201(355)298-161(69-74-205(359)360)229(387)301-160(45-35-82-286-269(279)280)228(386)333-192(119-428)255(413)307-162(68-73-198(274)352)230(388)316-176(94-141-54-64-150(350)65-55-141)241(399)304-159(44-34-
InChI key
GVUGOAYIVIDWIO-UFWWTJHBSA-N
Gene Information
human ... EGF(1950)
Looking for similar products? Visit Product Comparison Guide
Application
Biochem/physiol Actions
Cellular functions affected by EGF: mitosis, ion flux, glucose transport, glycolysis, nucleic acid and protein synthesis, survival, growth, proliferation and differentiation.
Biological affects of EGF: inhibition of gastric acid secretion, fetal growth and development and neuromodulation in the central nervous system.
Pathways affected by EGF: EGFR signaling, MAPK cascade, PIP, Ca+2 signaling
Components
Caution
Preparation Note
Analysis Note
Storage Class Code
11 - Combustible Solids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
-
what is the full peptide sequence of mature E9644 protein (~6kD)?
1 answer-
Helpful?
-
-
For the reconstitution in 10mM acetic acid and 0.1%BSA, do you use PBS or H20 for the rest of the solution?
1 answer-
After the material is reconstituted in 10mM acetic acid, the material can be aliquoted and stored at 2-8°C for one month, or frozen in aliquots at -70°C or -20°C for longer periods. If the stock solution is very dilute, at a concentration less than 10 ug/mL, then BSA or HSA should be added to a concentration of 0.1% in the acetic acid solution prior to reconstitution in order to maintain the stability of the product.
Helpful?
-
-
Can Epidermal Growth Factor (EGF) human, Product E9644, be used on rat cells?
1 answer-
This product has been tested for activity using the mouse Balb/3T3 cell line. We have not tested its activity in rat cell culture, but we expect that will also work in that application.
Helpful?
-
-
What is the molecular weight of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
The mature protein has a molecular weight of 6 kD.
Helpful?
-
-
How long can I store a solution of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
Solution stability can be found on the product data sheet. If Product No. E9644 has been reconstituted with 0.2 micron-filtered 10 mM acetic acid containing 0.1% HSA or BSA to a concentration of not less than 10 ug/ml, it can be stored at 2-8 °C for a maximum of one month. For extended storage, freeze in working aliquots at -70 °C or -20 °C. Repeated freezing and thawing is not recommended.
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
Can I use PBS to reconstitute Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
We recommend reconstitution with acetic acid to make sure the entire product will be solubilized. PBS can be used, but the total amount of the protein in the vial may not go into solution. It is best to make a higher concentration in acetic acid, and then dilute into PBS.
Helpful?
-
-
What is the difference between Product No. E9644 and E4269, Epidermal Growth Factor?
1 answer-
Product No. E9644 is the mature EGF protein. Long EGF (Product No. E4269) is an analog of epidermal growth factor comprising the human EGF amino acid sequence plus a 53 amino acid N-terminal extension peptide. Long EGF has been developed as an inexpensive, high quality potent analog of EGF for use as a growth factor supplement for serum-free or low-serum cell culture.
Helpful?
-
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service