SAB5702248

Anti-Folate Binding Protein(FBP) / FOLR1 Antibody, clone 3J6W3, Rabbit Monoclonal

• Sinónimos: FOLR1,FBP,FOLR
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 3J6W3, monoclonal
• Formulario: liquid
• mol peso: 38 kDa
• reactividad de especies: human, rat, rat
• concentración: 0.93 mg/mL
• técnicas: western blot: 1:500 - 1:1000
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF
• Nº de acceso UniProt: P15328
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... FOLR1(2348)

Descripción

Descripción general

The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene.

Inmunógeno

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Folate Binding Protein(FBP) / FOLR1 (NP_000793.1).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Aplicación

WB

Información de seguridad

• Pictogramas: GHS07,GHS09
• Palabra de señalización: Warning
• Frases de peligro: H317,H411
• Consejos de prudencia: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Clasificaciones de peligro: Aquatic Chronic 2 - Skin Sens. 1
• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3