SAB2108573

Anti-GLS2

IgG fraction of antiserum

• Sinónimos: Anti- GLS, Anti- LGA, Anti- MGC71567, Anti- hLGA, Anti-GA
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 36 kDa
• species reactivity: rat, horse, mouse, human, dog, pig
• concentration: 0.5-1 mg/mL
• technique(s): immunoblotting: suitable; immunohistochemistry: suitable
• accession no.: NM_013267
• UniProt accession no.: Q9UI32
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GLS2(27165)

Descripción

General description

Glutaminase 2 (GLS2) is located in mitochondria and nucleus. The gene is located on human chromosome 12q13. GLS2 protein is expressed in brain, pancreas, cancer cells and cells of the immune system.

Immunogen

Synthetic peptide directed towards the middle region of human GLS2

Biochem/physiol Actions

Glutaminase 2 (GLS2) is a mitochondrial phosphate-activated glutaminase that catalyses the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
GLS2 functions as a tumor protein p53 downstream target gene. GLS2 controls the functions of p53, in modulating energy metabolism and antioxidant defense. It might play a critical role in tumorigenesis. The protein negatively controls PI3K (phosphatidylinositol 3-kinase) /AKT (non-specific serine/threonine protein kinase) signalling pathway. GLS2 regulates the neuronal effects of tumor protein p73. The protein might have a pivotal role in radioresistance in cervical cancer patients.

Sequence

Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable