The brain derived neurotrophic factor (BDNF) gene is mapped to human chromosome 11p14.1. BDNF is a member of the neurotrophin family of growth factors. The gene encodes a precursor protein, proBDNF. Mature BDNF (mBDNF) is synthesized by post-translational cleavage of proBDNF. Both proBDNF and mBDNF play crucial roles in cellular signaling.
Immunogen
Synthetic peptide directed towards the middle region of human BDNF
Application
Anti-BDNF antibody produced in rabbit has been used in immunohistochemistry and western blotting.[1][2]
Biochem/physiol Actions
Brain derived neurotrophic factor (BDNF) is involved in hippocampal function and verbal episodic memory in humans. Hence, variation in the BDNF gene expression alters these neurological functions. BDNF also plays a vital role in vascular function and participates in angiogenesis via the specific receptor tropomyosin-related kinase B (TrkB). It is involved in the pathogenesis of Alzheimer′s disease. ProBDNF interacts with p75 neurotrophin receptor, leading to long-term depression in the hippocampus.
Sequence
Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Progress in neuro-psychopharmacology & biological psychiatry, 90, 62-75 (2018-11-06)
The canonical phosphodiesterase 4 (PDE4) inhibitors produce antidepressant-like effects in a variety of animal models. However, severe side effects, particularly vomiting and nausea, limit their clinical application. FCPR16 is a novel PDE4 inhibitor with less vomiting potential. However, whether it
Running wheel exercise reduces a-synuclein aggregation and improves motor and cognitive function in a transgenic mouse model of Parkinson's disease
Zhou W, et al.
PLoS ONE, 12 (2017)
Peripheral vascular reactivity and serum BDNF responses to aerobic training are impaired by the BDNF Val66Met polymorphism.
Frontiers in immunology, 11, 2146-2146 (2020-09-29)
In Brazil, an epidemic of Zika virus (ZIKV) infections was declared in 2015 that coincided with alarming reports of microcephaly in newborns associated with mother infection. Although the virus has placental tropism, changes in the tissue morphology and immunity of
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
