Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

AV54324

Sigma-Aldrich

Anti-IL1B antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-IL-1, Anti-IL1-BETA, Anti-IL1F2, Anti-Interleukin 1, β

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

17 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... IL1B(3553)

Descripción general

Interleukin-1β (IL1β) is produced by activated macrophages. It is synthesized as pro-IL-1β which is changed to active form IL-1β with the help of pro-inflammatory protease caspase-1. IL-1β belongs to the IL-1 gene family. It is a proinflammatory cytokine. The gene is mapped to human chromosome 2q14.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human IL1B

Aplicación

Anti-IL1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Acciones bioquímicas o fisiológicas

Interleukins are proinflammatory cytokines produced on cell injury or trauma. There are two closely related types of interleukins produced by the cell, IL-1α and IL-1β that are produced by the activation of NF-κB transcription factor in response to bacterial infection or LPS. Both IL-1α and IL-1β exert their cellular effects by signalling through IL-1 receptor type 1. IL-1β has pleiotropic activities and is protective against infections by recruitment of neutrophils to the infection site, secretion of cytokines and chemokines and activation of adhesion molecules. IL-1β overproduction has been implicated in many auto-immune and allergic disorders such as Cryopirin-associated periodic syndromes, Muckle-Wells syndrome and skin lesions.

Secuencia

Synthetic peptide located within the following region: DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Los clientes también vieron

Manoranjan Sahoo et al.
TheScientificWorldJournal, 11, 2037-2050 (2011-11-30)
The inflammasome is an important innate immune pathway that regulates at least two host responses protective against infections: (1) secretion of the proinflammatory cytokines IL-1β and IL-18 and (2) induction of pyroptosis, a form of cell death. Inflammasomes, of which
Axel Weber et al.
Science signaling, 3(105), cm1-cm1 (2010-01-21)
The interleukin-1 (IL-1) family of cytokines comprises 11 proteins (IL-1F1 to IL-1F11) encoded by 11 distinct genes in humans and mice. IL-1-type cytokines are major mediators of innate immune reactions, and blockade of the founding members IL-1alpha or IL-1beta by
Charles A Dinarello
Current opinion in pharmacology, 4(4), 378-385 (2004-07-15)
All biological agents currently used for reducing TNFalpha activity in disease are neutralization strategies; however, there are several strategies for reducing interleukin (IL)-1 activities: the IL-1 receptor antagonist (IL-1Ra), anti-IL-1beta monoclonal antibodies, the IL-1 Trap, IL-1 receptor type I antibodies
Emmanuel Contassot et al.
Swiss medical weekly, 142, w13590-w13590 (2012-06-02)
Interleukin 1, one of the first cytokines discovered in the 1980s, and a potent mediator of fever, pain and inflammation, is at present experiencing a revival in biology and medicine. Whereas the mechanism of activation and secretion of interleukin 1β

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico