AV49932
Anti-PLXNA2 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-FLJ11751, Anti-FLJ30634, Anti-KIAA0463, Anti-OCT, Anti-PLXN2, Anti-Plexin A2
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
211 kDa
reactividad de especies
mouse, rat, horse, dog, guinea pig, rabbit, human
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... PLXNA2(5362)
Descripción general
In the fetal samples, Plexin A2 (PLXNA2) has prominent expression in fetal neural tissue.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human PLXNA2
Aplicación
Anti-PLXNA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Acciones bioquímicas o fisiológicas
Plexin A2 (PLXNA2) is a coreceptor for semaphorins that are involved in immune responses, activation of immune cells and axon guidance during neuronal development. PLXNA2 acts as a receptor of Sema6A and has a role in limiting adult axon growth and recovery post trauma. PLXNA2 is up-regulated in metastatic prostate cancer tumors and breast cancer. Copy number variation in PLXNA2 is associated with Tetralogy of Fallot (TOF), a cyanotic congenital heart disease. Dysregulation of PLXNA2-semaphorin signaling results in congenital heart disease, characteristic of cardiac outflow tract (OFT) defect. PLXNA2 is up-regulated by osteogenic factor BMP2. Up-regulated PLXNA2 mediates osteoblast differentiation by regulation of RUNX2 (Runt-related transcription factor 2) expression.
Secuencia
Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
T V Tian et al.
Oncogene, 33(17), 2204-2214 (2013-05-28)
Prostate cancer (PCa) is one of the major public health problems in Western countries. Recently, the TMPRSS2:ERG gene fusion, which results in the aberrant expression of the transcription factor ERG, has been shown to be the most common gene rearrangement
Candice K Silversides et al.
PLoS genetics, 8(8), e1002843-e1002843 (2012-08-23)
Structural genetic changes, especially copy number variants (CNVs), represent a major source of genetic variation contributing to human disease. Tetralogy of Fallot (TOF) is the most common form of cyanotic congenital heart disease, but to date little is known about
Sang-Ohk Shim et al.
Molecular and cellular neurosciences, 50(2), 193-200 (2012-05-09)
Axonal growth from both intact and severed fibers is limited after adult mammalian CNS injury. Myelin proteins contribute to inhibition of axonal growth. Semaphorin6A protein inhibits the extension of developing axons and is highly expressed in adult oligodendrocytes. This expression
P N Gabrovska et al.
Gene, 489(2), 63-69 (2011-09-20)
Gene expression profiling has enabled us to demonstrate the heterogeneity of breast cancers. The potential of a tumour to grow and metastasise is partly dependant on its ability to initiate angiogenesis or growth and remodelling of new blood vessels, usually
E Maestrini et al.
Proceedings of the National Academy of Sciences of the United States of America, 93(2), 674-678 (1996-01-23)
In hunting for unknown genes on the human X chromosome, we identified a cDNA in Xq28 encoding a transmembrane protein (SEX) of 1871 amino acids. SEX shares significant homology with the extracellular domain of the receptors encoded by the oncogenes
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico