AV44806

Anti-USP48 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-DKFZp762M1713, Anti-MGC132556, Anti-MGC14879, Anti-RAP1GA1, Anti-USP31, Anti-Ubiquitin specific peptidase 48
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 70 kDa
• species reactivity: rat, guinea pig, rabbit, dog, mouse, horse, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_115612
• UniProt accession no.: Q86UV5-7
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... USP48(84196)

Descripción

Immunogen

Synthetic peptide directed towards the C terminal region of human USP48

Application

Anti-USP48 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Ubiquitin specific peptidase 48 (USP48; USP31) is a deubiquitinating enzyme that belongs to C19 peptidase family. It recognizes and hydrolyzes the peptide bond of ubiquitin at the C-terminal glycine. USP48 reportedly interacts with p65/RelA subunits of NF-κB and regulates its activation.

Sequence

Synthetic peptide located within the following region: PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable