AV35263

Anti-CLIC5 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Chloride intracellular channel 5
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 28 kDa
• reactividad de especies: rat, horse, bovine, human, guinea pig, rabbit
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_001107558
• Nº de acceso UniProt: Q53G01
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CLIC5(53405)

Descripción

Descripción general

CLIC5 is a chloride intracellular channel protein involved in hair cell stereocilia formation. It reportedly stabilizes membrane-actin filament links at the base of stereocilia. It has a role in the growth and differentiation of C2C12 myoblasts.
Rabbit Anti-CLIC5 antibody recognizes human, mouse, rat, pig, zebrafish, chicken, canine, and bovine CLIC5.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human CLIC5

Aplicación

Rabbit Anti-CLIC5 antibody is suitable for western blot (0.25 μg/ml) and IHC (4-8 μg/ml) applications.

Acciones bioquímicas o fisiológicas

Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.

Secuencia

Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable