Saltar al contenido
Merck
Todas las fotos(8)

Documentos clave

WH0004869M1

Sigma-Aldrich

Monoclonal Anti-NPM1 antibody produced in mouse

clone 3B2, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-B23, Anti-NPM, Anti-nucleophosmin (nucleolar phosphoprotein B23, numatrin)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

3B2, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

isotipo

IgG1κ

Nº de acceso GenBank

Nº de acceso UniProt

aplicaciones

research pathology

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... NPM1(4869)

Descripción general

NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]).[supplied by OMIM]
Nucleophosmin 1 (NPM1) is an important multifunctional protein mainly located in the nucleolus. This gene is located on human chromosome 5q35.

Inmunógeno

NPM1 (AAH02398.1, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Aplicación

Monoclonal Anti-NPM1 antibody produced in mouse has been used in immunoblotting.[1]
The antibody may be used for ELISA, competitive ELISA, immunoblotting (37 kDa), immunoprecipitation, immunohistochemistry, immunocytochemistry (2% formaldehyde-acetone 1,2,5 or 10% formalin/methanol-1% NP-40 and microinjection (blocks the initiation of centrosome duplication). Reactivity has been observed with human, monkey, bovine, dog, hamster (weak), rat,kangaroo rat, and mouse B23.

Acciones bioquímicas o fisiológicas

NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells.
NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells. Mutations in NPM1 result in acute myeloid leukemia (AML).

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

The linker histone H1. 2 is a novel component of the nucleolar organizer regions
Junjie C, et al.
The Journal of Biological Chemistry, M117-M117 (2018)
NPM1 Deletion Is Associated with Gross Chromosomal Rearrangements in Leukemia.
Starza RL, et al.
PLoS ONE, 5(9), e12855-e12855 (2010)
Relocation of NPM Affects the Malignant Phenotypes of Hepatoma SMMC-7721 Cells.
Li X, et al.
Journal of Cellular Biochemistry, 118(10), 3225-3236 (2017)
Dynamic localization of alpha-tubulin acetyltransferase ATAT1 through the cell cycle in human fibroblastic KD cells
Nekooki-Machida, et al.
Medical Molecular Morphology, 1-10 (2018)
Localization of AML-related nucleophosmin mutant depends on its subtype and is highly affected by its interaction with wild-type NPM.
Brodska B, et al.
PLoS ONE, 12(4), e0175175-e0175175 (2017)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico