WH0003559M4

Monoclonal Anti-IL2RA antibody produced in mouse

clone 1D6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-CD25, Anti-IL2R, Anti-TCGFR, Anti-interleukin 2 receptor, alpha
• MDL number: MFCD00164687
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1D6, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_000417
• UniProt accession no.: P01589
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... IL2RA(3559)

Descripción

General description

Interleukin 2 receptor alpha (IL2RA) is a part of the IL-2 receptor. It is expressed on regulatory T cells. IL2RA gene is mapped to human chromosome 10p15.1.

Immunogen

IL2RA (NP_000408, 22 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL*

Biochem/physiol Actions

Interleukin 2 receptor alpha (IL2RA) combines with a tri-molecular complex to exhibit a high-affinity receptor for IL-2. Activated immune cells release IL2RA and produce soluble (sIL2RA). Higher circulating levels of sIL2RA leads to multiple sclerosis (MS) disease activities. IL2RA initiates T cell proliferation in an autocrine and paracrine manner. Elevated levels of IL-2R is detected in coronavirus disease 2019 (COVID-19)infected patients.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)