WH0000174M1
Monoclonal Anti-AFP antibody produced in mouse
clone 1G7, purified immunoglobulin, buffered aqueous solution
Sinónimos:
Anti-FETA, Anti-HPAFP, Anti-alpha-fetoprotein
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
origen biológico
mouse
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
purified immunoglobulin
tipo de anticuerpo
primary antibodies
clon
1G7, monoclonal
Formulario
buffered aqueous solution
reactividad de especies
human
técnicas
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotipo
IgGκ
Nº de acceso GenBank
Nº de acceso UniProt
Condiciones de envío
dry ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... AFP(174)
Categorías relacionadas
Descripción general
This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. (provided by RefSeq)
Inmunógeno
AFP (AAH27881, 500 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Aplicación
Monoclonal Anti-AFP antibody produced in mouse has been used in immunocytochemistry.
Acciones bioquímicas o fisiológicas
Alpha-fetoprotein encoded by the gene AFP is involved in the regulation of fatty acids in both fetal and proliferating adult liver cells. Its expression is found to be increased in acute liver injuries, indicating active liver regeneration. It has been associated with fatty liver disease (FLD), a disease that may lead to cirrhosis and hepatocellular carcinoma. It serves as a tumor marker for HCC (hepatocellular carcinoma).
Características y beneficios
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Forma física
Solution in phosphate buffered saline, pH 7.4
Información legal
GenBank is a registered trademark of United States Department of Health and Human Services
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Opcional
Referencia del producto
Descripción
Precios
Código de clase de almacenamiento
10 - Combustible liquids
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Equipo de protección personal
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Elija entre una de las versiones más recientes:
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Anika Neureiter et al.
Stem cell research, 33, 20-24 (2018-10-09)
Angelman syndrome (AS) is a neurodevelopmental disorder with leading symptoms of happy demeanor, intellectual disability, ataxia and seizures. AS can be caused by genetic and epigenetic aberrations, resulting in the absence of functional UBE3A protein in the brain. UBE3A is
Björn Lichtner et al.
Stem cell research, 15(3), 697-699 (2016-03-19)
Primary human chorionic villi (CV) cells were used to generate the iPSC line by retroviral transduction of the four Yamanaka-factors OCT4, SOX2, KLF4 and c-MYC. Pluripotency was confirmed both in vivo and in vitro. The transcriptomes of the CV-derived iPSC
Carla Sanjurjo-Soriano et al.
Stem cell research, 33, 247-250 (2018-11-24)
We generated an induced pluripotent stem cell (iPSC) line using dermal fibroblasts from a patient with Usher syndrome type 2 (USH2). This individual was homozygous for the most prevalent variant reported in the USH2A gene, c.2299delG localized in exon 13.
Gergő Vőfély et al.
Molecular and cellular neurosciences, 88, 222-230 (2018-02-10)
Pluripotent stem cell derived human neuronal progenitor cells (hPSC-NPCs) and their mature neuronal cell culture derivatives may efficiently be used for central nervous system (CNS) drug screening, including the investigation of ligand-induced calcium signalization. We have established hippocampal NPC cultures
Julia Tigges et al.
ALTEX, 38(4), 595-614 (2021-05-09)
Human induced pluripotent stem cells (hiPSC) are a promising tool for replacing animal-based experiments. To warrant data reproducibility, quality-controlled research material is recommended. While the need for global harmonization of quality standards for stem cell banking centers, commercial providers, pre-clinical
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico