Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB2107086

Sigma-Aldrich

Anti-SNX10 antibody produced in rabbit

affinity isolated antibody

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

22 kDa

reactividad de especies

rat, human, mouse, bovine, pig, horse, rabbit

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SNX10(29887)
mouse ... Snx10(71982)

Categorías relacionadas

Descripción general

Sorting nexin 10 (SNX10) is a transmembrane protein belonging to SNX family. SNX10 has phox domain which binds to phosphoinositide-binding domain. In human chromosome, the gene SNX10 is located on 7p15.2.

Inmunógeno

The immunogen for anti-SNX10 antibody: synthetic peptide derected towards the middle region of human SNX10

Acciones bioquímicas o fisiológicas

Snx10 may be involved in several stages of intracellular trafficking. May play a role in endosome homeostasis. Overexpression causes formation of huge vacuoles. Mutations in SNX10 leads to autosomal recessive osteoporosis due to dysregulation of osteoclasts. SNX10 interaction with vacuolar-type H+ -ATPase (V-ATPase) complex initiates ciliogenesis, critical for early embryonic development.

Secuencia

Synthetic peptide located within the following region: DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

12 - Non Combustible Liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

SNX10 gene mutation leading to osteopetrosis with dysfunctional osteoclasts
Stattin EL, et al.
Scientific Reports, 7(1), 3012-3012 (2017)
A novel mutation in SNX10 gene causes malignant infantile Osteopetrosis
Amirfiroozy A, et al.
Avicenna Journal of Medical Biotechnology, 9(4), 205-205 (2017)
Ting Hu et al.
Folia neuropathologica, 59(4), 359-371 (2022-02-05)
Gliomas are the most seen tumours in adults in the central nervous system, and high grade of gliomas cause the worse prognose of patients with a shorter survival period. Ubiquitin-specific protease 38 (USP38) has been regarded as the negative regulator
An inducible explant model of osteoclast-osteoprogenitor coordination in exacerbated osteoclastogenesis.
Whitlock, et al.
iScience, 26, 106470-106470 (2023)
Yanqun Chen et al.
Cell research, 22(2), 333-345 (2011-08-17)
Sorting nexins (SNXs) are phosphoinositide-binding proteins implicated in the sorting of various membrane proteins in vitro, but the in vivo functions of them remain largely unknown. We reported previously that SNX10 is a unique member of the SNX family genes

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico