SAB2104126

Anti-TEAD2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ETF, Anti-TEF4
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 49 kDa
• species reactivity: horse, mouse, bovine, guinea pig, rat, human, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_003598
• UniProt accession no.: Q15562
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TEAD2(8463)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human TEAD2

Biochem/physiol Actions

TEAD2 is a putative transcription factor that binds to the SPH and GT-IIC enhansons (5′-GTGGAATGT-3′). TEAD2 may be involved in the gene regulation of neural development. TEAD2 binds to the M-CAT motif.

Sequence

Synthetic peptide located within the following region: SGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable