SAB2102117

Anti-SETD3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-C14orf154, Anti-DKFZp761E1415, Anti-FLJ23027, Anti-MGC87236, Anti-SET domain containing 3
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 34 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q86TU7
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SETD3(84193)

Descripción

General description

The previously assigned protein identifier A0PJU3 has been merged into Q86TU7. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the middle region of human SETD3

Biochem/physiol Actions

SETD3 contains 1 SET domain.

Sequence

Synthetic peptide located within the following region: AVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLTPEDSFALAVASA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable