Saltar al contenido
Merck
Todas las fotos(4)

Documentos clave

SAB1412356

Sigma-Aldrich

ANTI-PAX7 antibody produced in mouse

clone 1G11, purified immunoglobulin, buffered aqueous solution

Sinónimos:

HUP1, PAX7, PAX7B

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1G11, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen 37.84 kDa

reactividad de especies

human

técnicas

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG2bκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PAX7(5081)

Descripción general

Paired box 7 (PAX7) is encoded by the gene mapped to human chromosome 1p36.13. The encoded protein belongs to the PAX family and is expressed in central nervous system (CNS), craniofacial tissue, somites/skeletal muscle. PAX7 protein consists of paired domain (PD), an octapeptide (OP) motif and the helix-turn-helix motif of the homeodomain 1, 2 and 3 (HD1/2/3).
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Inmunógeno

PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT

Acciones bioquímicas o fisiológicas

Paired box 7 (PAX7) in muscle-derived stem cells, plays an essential role in myogenic satellite cell specification, by inhibiting alternate developmental programs. Variation in the gene expression is associated with melanoma, neuroblastoma, rhabdomyosarcoma. PAX7 and PAX3 is also implicated in skeletal muscle formation and regeneration.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Margaret Buckingham et al.
Annual review of cell and developmental biology, 23, 645-673 (2007-05-18)
Pax genes play key roles in the formation of tissues and organs during embryogenesis. Pax3 and Pax7 mark myogenic progenitor cells and regulate their behavior and their entry into the program of skeletal muscle differentiation. Recent results have underlined the
T H Beaty et al.
Human genetics, 132(7), 771-781 (2013-03-21)
A collection of 1,108 case-parent trios ascertained through an isolated, nonsyndromic cleft lip with or without cleft palate (CL/P) was used to replicate the findings from a genome-wide association study (GWAS) conducted by Beaty et al. (Nat Genet 42:525-529, 2010)
P Seale et al.
Cell, 102(6), 777-786 (2000-10-13)
The paired box transcription factor Pax7 was isolated by representational difference analysis as a gene specifically expressed in cultured satellite cell-derived myoblasts. In situ hybridization revealed that Pax7 was also expressed in satellite cells residing in adult muscle. Cell culture
Cecilia Romagnoli et al.
International journal of molecular sciences, 22(14) (2021-07-25)
Skeletal muscle has an outstanding capacity for regeneration in response to injuries, but there are disorders in which this process is seriously impaired, such as sarcopenia. Pharmacological treatments to restore muscle trophism are not available, therefore, the identification of suitable

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico