SAB1402660

Monoclonal Anti-ACVR1C antibody produced in mouse

clone 2E3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: ACVRLK7, ALK7
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2E3, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~35.9 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; proximity ligation assay: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: BC022530
• Nº de acceso UniProt: Q8NER5
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ACVR1C(130399)

Descripción

Descripción general

ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM

Inmunógeno

ACVR1C (AAH22530.1, 23 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable