Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

MSQC18

Sigma-Aldrich

SILu™Lite SigmaMAb Cetuximab Monoclonal Antibody

recombinant, expressed in CHO cells

Sinónimos:

Mass spectrometry standard, Cetuximab

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
41105331
NACRES:
NA.41

recombinante

expressed in CHO cells

Ensayo

≥90% (SDS-PAGE)

Formulario

solid

idoneidad

suitable for mass spectrometry

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Descripción general

SigmaMAb Cetuximab (MSQC18) was designed to be a standard for the analysis of Cetuximab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Cetuximab (MSQC19).

SigmaMAb Cetuximab is for R&D use only. Not for drug, household, or other uses.

Aplicación

SILu™ Lite SigmaMAb Cetuximab Monoclonal Antibody has been used in isoluminol enhanced chemiluminescence assay to measure the reactive oxygen species (ROS) production from monocytes.

Secuencia

SigmaMab Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SigmaMab Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Información legal

SILu is a trademark of Sigma-Aldrich Co. LLC

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
0000265873
0000254743
0000254743
0000265873
SLCJ5716

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Sachin Surve et al.
The Journal of cell biology, 220(11) (2021-09-14)
The subcellular localization of RAS GTPases defines the operational compartment of the EGFR-ERK1/2 signaling pathway within cells. Hence, we used live-cell imaging to demonstrate that endogenous KRAS and NRAS tagged with mNeonGreen are predominantly localized to the plasma membrane. NRAS
Ali A Akhiani et al.
Cancer immunology research, 8(12), 1532-1541 (2020-09-25)
The phosphatidylinositol-4,5-bisphosphate-3 kinase-δ (PI3Kδ) inhibitor idelalisib, used alone or in combination with anti-CD20, is clinically efficacious in B-cell lymphoma and chronic lymphocytic leukemia (CLL) by promoting apoptosis of malignant B cells. PI3K regulates the formation of reactive oxygen species (ROS)

Artículos

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Ver todo

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico