Saltar al contenido
Merck
Todas las fotos(7)

Key Documents

HPA044582

Sigma-Aldrich

Anti-SFTPD antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-COLEC7, Anti-SFTP4, Anti-SP-D

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:2500-1:5000

immunogen sequence

LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SFTPD(6441)

General description

Surfactant protein D (SFTPD) is expressed majorly by alveolar type II cells of the lung, epithelial surfaces, amniotic fluid and serum. The gene is located on human chromosome 10q22.3. It consists of an N-terminal domain with two conserved cysteines, a collagen-like region, an α helical neck region and a C-type lectin carbohydrate recognition domain (CRD).

Immunogen

surfactant protein D

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SFTPD antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

Surfactant protein D (SFTPD) plays an important role in innate immune system. It is linked to macrophage mediated inhibition of interleukin IL-12p40 via signal regulatory protein α (SIRPα)/ Rho-associated protein kinase (ROCK)/ extracellular signal regulated kinases (ERK) signalling pathway. The protein plays an anti-inflammatory role in lungs. SFTPD maintains surfactant homeostasis by regulating the structure of surfactant phospholipids.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST80249

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

In defense of the lung: surfactant protein A and surfactant protein D
Kingma PS, et al.
Current Opinions in Pharmacology, 6(3), 277-283 (2006)
Structure binding relationship of human surfactant protein D and various lipopolysaccharide inner core structures
Reinhardt A, et al.
Journal of Structural Biology, 195(3), 387-395 (2016)
Surfactant Protein D Inhibits Interleukin-12p40 Production by Macrophages Through the SIRPα/ROCK/ERK Signaling Pathway
Yamaguchi R, et al.
The American Journal of the Medical Sciences, 353(6), 559-567 (2017)
A common polymorphism in the SFTPD gene influences assembly, function, and concentration of surfactant protein D
Leth-Larsen R, et al.
Journal of Immunology, 174(3), 1532-1538 (2005)
Surfactant protein A genetic variants associate with severe respiratory insufficiency in pandemic influenza A virus infection
Herrera-Ramos E, et al.
Critical Care, 18(3), R127-R127 (2014)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico