Saltar al contenido
Merck

HPA021367

Sigma-Aldrich

Anti-IGF2BP1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-CRD-BP, Anti-Coding region determinant-binding protein, Anti-IGF-II mRNA-binding protein 1, Anti-IGF2 mRNA-binding protein 1, Anti-IMP-1, Anti-Insulin-like growth factor 2 mRNA-binding protein 1, Anti-VICKZ family member 1, Anti-ZBP-1, Anti-Zip code-binding protein 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

DVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IGF2BP1(10642)

General description

The gene IGF2BP1 (insulin-like growth factor 2 mRNA-binding protein 1) is mapped to human chromosome 17q21. It belongs to the IGF (insulin-like growth factor)-II mRNA-binding proteins family. The protein contains RNA recognition motifs and K-homology domains. IGF2BP1 localizes mainly in the cytoplasm and subcytoplasmic domains. IGF2BP1 is also referred to as IMP1 (insulin-like growth factor 2 mRNA-binding protein 1) or CRD-BP (coding region determinant-binding protein).

Immunogen

Insulin-like growth factor 2 mRNA-binding protein 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-IGF2BP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

IGF2BP1 (insulin-like growth factor 2 mRNA-binding protein 1) is important for the mRNA localization, turnover and translational control. It binds to the target mRNAs and thereby regulates its cytoplasmic fate. For instance, it binds to the 3′-untranslated region of CD44 mRNA and stabilizes it. Similarly, it interacts with the coding region of βTrCP1 (F-box and WD repeats protein) mRNA and stabilizes it. IGF2BP1 is up-regulated in non-small cell lung cancers and is associated with tumor progression. It is also up-regulated in neuroblastoma.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75731

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Aiting Yan et al.
Oncology letters, 20(6), 359-359 (2020-11-03)
Esophageal cancer (ESCA) is the eighth most common cause of cancer-associated mortality in humans. An increasing number of studies have demonstrated that microRNAs (miRs) serve important roles in mediating tumor initiation and progression. miR-454-3p has been found to be involved
Mark Barnes et al.
The Journal of biological chemistry, 290(1), 625-639 (2014-11-13)
The ability of its four heterogeneous nuclear RNP-K-homology (KH) domains to physically associate with oncogenic mRNAs is a major criterion for the function of the coding region determinant-binding protein (CRD-BP). However, the particular RNA-binding role of each of the KH
J Nielsen et al.
Molecular and cellular biology, 19(2), 1262-1270 (1999-01-16)
Insulin-like growth factor II (IGF-II) is a major fetal growth factor. The IGF-II gene generates multiple mRNAs with different 5' untranslated regions (5' UTRs) that are translated in a differential manner during development. We have identified a human family of
Jessica L Bell et al.
Journal of clinical oncology : official journal of the American Society of Clinical Oncology, 33(11), 1285-1293 (2015-03-11)
Chromosomal 17q21-ter gain in neuroblastoma is both a common and prognostically significant event. The insulin-like growth factor-2 mRNA-binding protein 1 (IGF2BP1) gene is located near the proximal edge of this region. Here, its prognostic value is evaluated in neuroblastoma. The
Jacob Nielsen et al.
The Biochemical journal, 376(Pt 2), 383-391 (2003-08-19)
The human IMPs (insulin-like growth factor II mRNA-binding proteins) belong to a vertebrate zipcode-binding protein family consisting of two RNA recognition motifs and four K homology domains and have been implicated in cytoplasmic mRNA localization, turnover and translational control. In

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico