Saltar al contenido
Merck
Todas las fotos(4)

Documentos clave

HPA014736

Sigma-Aldrich

Anti-SLC13A3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Na(+)/dicarboxylate cotransporter 3, Anti-NaDC-3, Anti-Sodium-dependent high-affinity dicarboxylate transporter 2, Anti-Solute carrier family 13 member 3, Anti-hNaDC3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnicas

immunohistochemistry: 1:50- 1:200

secuencia del inmunógeno

SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFL

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLC13A3(64849)

Descripción general

SLC13A3 (solute carrier family 13, member 3) belongs to SLC13 family of five members. This family is divided into Na+-sulphate (NaS) cotransporters and Na+-carboxylate (NaC) cotransporters, and SLC13A3 belongs to the latter group. It is a transporter with 12 transmembrane regions, and is composed of 602 amino acids. This gene maps to human chromosome 20q12-13.1, spans more than 80kb, and has 13 exons, and 12 introns. It has three predicted N-linked glycosylation sites. It is localized to the proximal tubule cells in the basolateral membrane. It is also expressed in brain, liver, pancreas and placenta.

Inmunógeno

Solute carrier family 13 member 3 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

SLC13A3 (solute carrier family 13, member 3) acts in collaboration with organic anion transporter 1 (OAT1) and OAT3) to facilitate the release of multiple endogenous and exogenous organic ions. It provides intracellular α-ketoglutarate, in a Na+-dependent manner, to OAT1 and 3, to allow for organic anion/dicarboxylate exchange. It is a glutathione (GSH) transporter of low-affinity. It is responsible for the uptake of GSH by the proximal tubule cells of basolateral membrane, in a sodium-dependent manner. Mutations in this gene might have a link to idiopathic nephrolithiasis. This transporter is also responsible for the uptake of N-carbamoylglutamate (NCG) from blood. NCG is a drug which is used to treat inborn n-acetylglutamate synthase deficiency. SLC13A3 might be involved in myelination, as it is responsible for the Na+-dependent transport of N-acetylaspartate in brain.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73142

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Lena Schorbach et al.
Nephron. Physiology, 124(1-2), 1-5 (2013-11-20)
During a single pass through the kidneys, more than 80% of glutathione (GSH) is excreted, indicating not only glomerular filtration, but also tubular secretion. The first step in tubular secretion is the uptake of a substance across the basolateral membrane
Daniel Markovich et al.
Pflugers Archiv : European journal of physiology, 447(5), 594-602 (2003-08-14)
The SLC13 gene family consist of five sequence-related members that have been identified in a variety of animals, plants, yeast and bacteria. Proteins encoded by these genes are divided into two functionally unrelated groups: the Na(+)-sulphate (NaS) cotransporters and the
W Huang et al.
The Journal of pharmacology and experimental therapeutics, 295(1), 392-403 (2000-09-19)
N-Acetylaspartate is a highly specific marker for neurons and is present at high concentrations in the central nervous system. It is not present at detectable levels anywhere else in the body other than brain. Glial cells express a high-affinity transporter
H Wang et al.
American journal of physiology. Cell physiology, 278(5), C1019-C1030 (2000-05-04)
We have cloned and functionally characterized the human Na(+)-dependent high-affinity dicarboxylate transporter (hNaDC3) from placenta. The hNaDC3 cDNA codes for a protein of 602 amino acids with 12 transmembrane domains. When expressed in mammalian cells, the cloned transporter mediates the
Elisabeth Schwob et al.
American journal of physiology. Renal physiology, 307(12), F1373-F1379 (2014-10-31)
Inborn defects in N-acetylglutamate (NAG) synthase (NAGS) cause a reduction of NAG, an essential cofactor for the initiation of the urea cycle. As a consequence, blood ammonium concentrations are elevated, leading to severe neurological disorders. The orphan drug N-carbamoylglutamate (NCG;

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico