Synthetic peptide directed towards the N terminal region of human KYNU
Aplicación
Anti-KYNU (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.
Acciones bioquímicas o fisiológicas
KYNU gene encodes a pyridoxal-5′-phosphate-(pyridoxal-P)-dependent enzyme, Kynureninase that catalyzes the cleavage of L-kynurenine into anthranilic acid and L-3-hydroxykynurenine into 3-hydroxyanthranilic acid. It facilitates the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.
Secuencia
Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Kynureninase [E.C.3.7.1.3.] is one of the enzymes involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. By tryptic and CNBr digestion of purified rat liver kynureninase, we obtained about 28% of the amino acid sequence of
European journal of biochemistry, 239(2), 460-468 (1996-07-15)
Kynureninase (L-kynurenine hydrolase), a pyridoxal-5'-phosphate-(pyridoxal-P)-dependent enzyme, catalyses the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. In this report, we describe the isolation of a cDNA clone encoding human kynureninase. Degenerate oligonucleotides designed from the amino acid
Questions
Reviews
★★★★★ No rating value
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.