Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV44768

Sigma-Aldrich

Anti-PLD3 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-HU-K4, Anti-Phospholipase D family, member 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

55 kDa

reactividad de especies

mouse, rabbit, bovine, horse, guinea pig, human, rat, dog

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PLD3(23646)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human PLD3

Aplicación

Anti-PLD3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Acciones bioquímicas o fisiológicas

Phospholipase D (PLD) family, member 3 belongs to the PLD family of enzymes that hydrolyze the membrane phospholipids. PLD3 is associated with the endoplasmic reticulum and is expressed in a variety of tissues and cells. The expression of PLD3 increases drastically in neurons and muscle cells during differentiation. PLD3 is involved in the processing of amyloid-beta precursor protein and myogenesis during the formation of the myotube.

Secuencia

Synthetic peptide located within the following region: WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Mary Osisami et al.
PloS one, 7(3), e33341-e33341 (2012-03-20)
Phospholipase D3 (PLD3) is a non-classical, poorly characterized member of the PLD superfamily of signaling enzymes. PLD3 is a type II glycoprotein associated with the endoplasmic reticulum, is expressed in a wide range of tissues and cells, and undergoes dramatic
Carlos Cruchaga et al.
Nature, 505(7484), 550-554 (2013-12-18)
Genome-wide association studies (GWAS) have identified several risk variants for late-onset Alzheimer's disease (LOAD). These common variants have replicable but small effects on LOAD risk and generally do not have obvious functional effects. Low-frequency coding variants, not detected by GWAS

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico