AV44234

Anti-GUSB antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Glucuronidase, β, Anti-MPS7
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 72 kDa
• reactividad de especies: mouse, horse, guinea pig, rabbit, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_000172
• Nº de acceso UniProt: P08236
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... GUSB(2990)

Descripción

Descripción general

β-Glucuronidase (GUSB), a lysosomal enzyme, catalyzes the breakdown of complex carbohydrates by hydrolyzing β-D-glucuronic acid residues from the non-reducing end of mucopolysaccharides. GUSB is a stably expressed gene product that may be used to normalize the expression of other genes in processes such as mesenchymal stem cell differentiation.

Especificidad

Anti-GUSB polyclonal antibody reacts with canine, bovine, zebrafish, chicken, human, mouse, rat, and pig β-glucuronidase proteins.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human GUSB

Aplicación

Anti-GUSB polyclonal antibody is used to tag β-glucuronidase protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe detect the presence of β-glucuronidase as a gene expression normalization reference protein.

Acciones bioquímicas o fisiológicas

GUSB plays an important role in the degradation of dermatan and keratan sulfates.

Secuencia

Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable